PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09567.2.p
Common NameBRADI_4g09567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 238aa    MW: 27238.1 Da    PI: 8.7913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09567.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141058148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv+ v+++G ++W+ +a+  g   Rt+k+c +rw +yl
  Bradi4g09567.2.p 10 KGPWTEQEDLQLVRTVRLFGDRRWDFVAKVSGlRDRTGKSCHLRWVNYL 58
                      79*********************************************97 PP

2Myb_DNA-binding46.21.1e-1465109248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       gr++++E+ l++++++++ ++ W++Ia +++ gRt++++k++w++++
  Bradi4g09567.2.p  65 GRMSPQEEHLIIELHARWVNR-WSRIAGRLP-GRTDNEIKNYWRTHM 109
                       89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.982558IPR017930Myb domain
SuperFamilySSF466891.95E-268105IPR009057Homeodomain-like
SMARTSM007176.5E-13960IPR001005SANT/Myb domain
PfamPF002498.4E-141058IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-181165IPR009057Homeodomain-like
CDDcd001671.53E-101258No hitNo description
PROSITE profilePS5129422.46359113IPR017930Myb domain
SMARTSM007172.5E-1263111IPR001005SANT/Myb domain
PfamPF002493.1E-1365108IPR001005SANT/Myb domain
CDDcd001671.33E-966109No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2266112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVTVRDEMRK GPWTEQEDLQ LVRTVRLFGD RRWDFVAKVS GLRDRTGKSC HLRWVNYLHP  60
GLKHGRMSPQ EEHLIIELHA RWVNRWSRIA GRLPGRTDNE IKNYWRTHMR KKAQERKTGM  120
SPSSCSSFTY QSGLIQTAPI TGKEEGNSSN GSTCISSVLK SNQSVMDGYS MDQIWREIVA  180
PAMLPIDDKA CSNFPCPLLP SPMRDWHYPE VVWKIDDDDM KMLAPEFGYV TGGGSCY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2671131105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672181e-157AK367218.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2053B03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237384.11e-126PREDICTED: myb-related protein MYBAS1-like
SwissprotQ53NK61e-116MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A0Q3PDA01e-180A0A0Q3PDA0_BRADI; Uncharacterized protein
STRINGBRADI4G09567.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.37e-75myb domain protein 59